PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C016789P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 270aa    MW: 29740.4 Da    PI: 9.245
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C016789P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-18853147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Edell ++v+ +G+++W++I++ +  gR++k+c++rw + 
   MELO3C016789P1  8 KGPWSPDEDELLRRLVHNYGPRNWSLISKSIS-GRSGKSCRLRWCNQ 53
                     79******************************.***********985 PP

2Myb_DNA-binding54.72.3e-1762104347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T++Ed+ +++a+ ++G++ W+tIar ++ gRt++ +k++w++ 
   MELO3C016789P1  62 PFTPDEDDTIIQAHSRFGNK-WATIARLLN-GRTDNAIKNHWNST 104
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.789358IPR017930Myb domain
SuperFamilySSF466899.36E-325101IPR009057Homeodomain-like
SMARTSM007174.7E-16756IPR001005SANT/Myb domain
PfamPF002492.5E-18853IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-25961IPR009057Homeodomain-like
CDDcd001671.56E-151052No hitNo description
SMARTSM007172.0E-1459107IPR001005SANT/Myb domain
PROSITE profilePS5129420.8260109IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2362108IPR009057Homeodomain-like
CDDcd001671.32E-1162105No hitNo description
PfamPF002494.9E-1562104IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MATTDRIKGP WSPDEDELLR RLVHNYGPRN WSLISKSISG RSGKSCRLRW CNQLSPEVEH  60
RPFTPDEDDT IIQAHSRFGN KWATIARLLN GRTDNAIKNH WNSTLKRKSS SSAPEDDHPL  120
KRSASVGAPP LYFNPSSPSG SDLSDSSLSG MSSSQVCKTF PPVPLISHSN QHPMETTSID  180
PPTSLTLSLP GSDSGEAPKH MSEGNHQSGK KAGIEKQFFS AEFLGVMQEM IRKEVQSYMS  240
GMEQNGLCLQ TEAITNAVVK RIGIRKIRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-4171083104MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-4171083104C-Myb DNA-Binding Domain
1msf_C5e-4171083104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008452606.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-82MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0A0L3P91e-161A0A0A0L3P9_CUCSA; Uncharacterized protein
STRINGPOPTR_0002s12410.11e-117(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.14e-65myb domain protein 77